PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00706.1_g00025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 267aa    MW: 30124.6 Da    PI: 6.8307
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00706.1_g00025.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-141461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l++ +   G  +W++ ++  g++R++k+c++rw +yl
  Rsa1.0_00706.1_g00025.1 14 KGPWTAEEDKKLINFILTSGHCCWRALPKLAGLRRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding51.52.4e-1671111547
                              -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              + +E++l +d+++ lG++ W++Ia++++ gRt++++k++w+++
  Rsa1.0_00706.1_g00025.1  71 SHDEEQLVIDLHAHLGNK-WSKIASRLP-GRTDNEIKNHWNTH 111
                              789***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-20562IPR009057Homeodomain-like
PROSITE profilePS5129411.41961IPR017930Myb domain
SuperFamilySSF466893.35E-2613108IPR009057Homeodomain-like
SMARTSM007171.1E-111363IPR001005SANT/Myb domain
PfamPF002492.7E-131461IPR001005SANT/Myb domain
CDDcd001671.05E-81661No hitNo description
PROSITE profilePS5129427.37162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2463117IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
CDDcd001679.06E-1171112No hitNo description
PfamPF002491.2E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRQPCCDKL VVKKGPWTAE EDKKLINFIL TSGHCCWRAL PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SHDEEQLVID LHAHLGNKWS KIASRLPGRT DNEIKNHWNT HIKKKLVKMG  120
IDPVTHQPLC QEPNNTNNPK NLSSTSDDIS MKPRSGSTKE TNGTITEDES SSTVTGQNSS  180
ADNENHLLSN IYNYEELFSH LWSEETPTAE ASWSDSNYGF GGTLHHHDNN MSGAGADFPI  240
WSPEGINGKD WTFLDYCQDF GVHDFGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013586436.10.0PREDICTED: protein ODORANT1
RefseqXP_013740433.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-89ODO1_PETHY; Protein ODORANT1
TrEMBLA0A078D6V30.0A0A078D6V3_BRANA; BnaC01g14080D protein
TrEMBLA0A0D3A5860.0A0A0D3A586_BRAOL; Uncharacterized protein
STRINGBra013633.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number</